PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013618404.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 329aa    MW: 37211.6 Da    PI: 6.1873
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013618404.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.34.2e-141461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd++l++ +   G  +W++ ++  g+ R++k+c++rw +yl
   XP_013618404.1 14 KGPWTVEEDKKLINFILTNGQCCWRALPKLSGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding543.9e-1771111547
                      -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++ E++ ++d+++qlG++ W++Ia++++ gRt++++k++w+++
   XP_013618404.1  71 SENEEQMIIDLHAQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
                      789***************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-19563IPR009057Homeodomain-like
PROSITE profilePS5129412.65961IPR017930Myb domain
SuperFamilySSF466896.36E-2711108IPR009057Homeodomain-like
SMARTSM007173.1E-111363IPR001005SANT/Myb domain
PfamPF002491.7E-121461IPR001005SANT/Myb domain
CDDcd001678.72E-81661No hitNo description
PROSITE profilePS5129427.03962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-2564116IPR009057Homeodomain-like
SMARTSM007173.8E-1566114IPR001005SANT/Myb domain
PfamPF002496.8E-1570111IPR001005SANT/Myb domain
CDDcd001673.32E-1171112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTVE EDKKLINFIL TNGQCCWRAL PKLSGLLRCG KSCRLRWINY  60
LRPDLKRGLL SENEEQMIID LHAQLGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLRKMG  120
IDPMTHKPLS EQEGAQQQAQ GTKKSLVSRD EKKRNQGQED QQTRKEEDQQ HQLGKHLDKN  180
NTPISTDDGF CIDDIPLLNP HEIFVDISSA HHHTSDGNAN INISNSTSPS SSSSPTSSCI  240
SSLPGDEFSK FLDEMEIVDL KWLSSDDSSG GDINYKDGKF NNNVDTMNLW DINDLSSLEL  300
FMNDHDDSVV GSGCSRMVLD HDSWTFDLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28121165108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00513DAPTransfer from AT5G16600Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF9747510.0KF974751.1 Brassica napus MYB transcription factor 43-1 (MYB43-1.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013618404.10.0PREDICTED: myb-related protein 308-like
TrEMBLA0A0D3AJD60.0A0A0D3AJD6_BRAOL; Uncharacterized protein
STRINGAT5G16600.11e-166(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16600.11e-158myb domain protein 43